PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041748m
Common NameCISIN_1g041748mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 480aa    MW: 55334.8 Da    PI: 6.8793
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041748mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.34.9e-92934761373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lLl  A+a ++++ +la + L++l +++s +gd++qR++a+f+ +Laarl+   s  y+ ++ ++t+    +ee+ a++ ++ vsP+++
  orange1.1g041748m  93 LIHLLLITATAADENNVSLALENLTELYQTVSLTGDSVQRVVAHFADGLAARLLTRRSPFYEMITKQPTE----EEEFLAFTDLYRVSPYFQ 180
                        689****************************************************99****999888886....788888899********* PP

               GRAS  93 fshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpf 176
                        ++h+taNqaIlea+e++     +++H+iDfd+s+G+QWp+L+q+L++++  ++  s+RiTg+g+    s eel+et++rL +f +++ ++ f
  orange1.1g041748m 181 LAHFTANQAILEAFEEQiennnRALHVIDFDVSYGFQWPSLIQSLSEKAtnGNRISFRITGFGR----SIEELQETENRLVSFSKSFrNLVF 268
                        **************99888887899**********************99745555*********....9*****************857*** PP

               GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                        ef+ l    +   +l ++r k++E++a nlv++l +l    ++    ++++L+lv+s++P++v++veqe +++  +Fl rf+e+l+y++a+f
  orange1.1g041748m 269 EFQGL----IRGSRLVNIRKKKHETVAANLVFHLNTLK-IYLK----ISDTLNLVRSIKPTIVTLVEQEGSRSPRNFLSRFMESLHYFAAMF 351
                        ****7....55566679999**************9997.3333....367****************************************** PP

               GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerre......rhetlekWrerleeaGFkpvplsekaakqaklllr............ 342
                        dsl+  lp+es++r ++E+ +lg+ei++++ c +++  +      r e++e+W++r+e+  F+ +++s+k   qaklll+            
  orange1.1g041748m 352 DSLDDCLPQESNKRLSIEKNYLGKEIKSMLNCDESDNGNydnyypRYERMETWKARMESHEFGGIKMSSKSLIQAKLLLKirthycplqfde 443
                        ********************************998754333334499*******************************97333333322221 PP

               GRAS 343 kvksdgyrveee.sgslv.lgWkdrpLvsvSaW 373
                        + +++g++v e+ +g ++ lgW+dr L++++aW
  orange1.1g041748m 444 ENNNNGFKVFERyDGKAIsLGWQDRCLLTATAW 476
                        3346677776667777777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.45167443IPR005202Transcription factor GRAS
PfamPF035141.7E-8993476IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MEDTEEEEEF LALRLAIVAS DSCSVDKQRK RKRITRVSLN SSNISPYHHE GCCVSEGKIF  60
RLLQMREQML KLDHKRKGVV DEDGNNNNKG LHLIHLLLIT ATAADENNVS LALENLTELY  120
QTVSLTGDSV QRVVAHFADG LAARLLTRRS PFYEMITKQP TEEEEFLAFT DLYRVSPYFQ  180
LAHFTANQAI LEAFEEQIEN NNRALHVIDF DVSYGFQWPS LIQSLSEKAT NGNRISFRIT  240
GFGRSIEELQ ETENRLVSFS KSFRNLVFEF QGLIRGSRLV NIRKKKHETV AANLVFHLNT  300
LKIYLKISDT LNLVRSIKPT IVTLVEQEGS RSPRNFLSRF MESLHYFAAM FDSLDDCLPQ  360
ESNKRLSIEK NYLGKEIKSM LNCDESDNGN YDNYYPRYER METWKARMES HEFGGIKMSS  420
KSLIQAKLLL KIRTHYCPLQ FDEENNNNGF KVFERYDGKA ISLGWQDRCL LTATAWHCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-36984778375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12530DKQRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006473211.10.0PREDICTED: scarecrow-like protein 21
TrEMBLA0A067GZ230.0A0A067GZ23_CITSI; Uncharacterized protein
STRINGPOPTR_0013s11930.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15761916
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.16e-53SCARECROW-like 21